DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19a and Or67c

DIOPT Version :9

Sequence 1:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster


Alignment Length:232 Identity:49/232 - (21%)
Similarity:99/232 - (42%) Gaps:36/232 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LMYPTWIPWNWRDSTSAYLATAMLHTTALMANATLVLNLSSYPGTYLILVSVHTKALALRVSKLG 220
            |:|  ||.: |..:..||||....    |.|:..||:.::.        :.:|...:::|:....
  Fly   193 LIY--WIMY-WDIAHGAYLAGIAF----LCADLLLVVVITQ--------ICMHFNYISMRLEDHP 242

  Fly   221 YGAPLPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIM 285
            ..:......:: .|:|.|..|...|:|.:.:....|.:..|.|...:...|.|.:.:....|.::
  Fly   243 CNSNEDKENIE-FLIGIIRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEVI 306

  Fly   286 RFMNMLFLLVILTT--ETLLLCYTAELPCKEGESLLT-------AVYSCNWLSQSVNFRRLLLLM 341
                :::.:.::|:  :..::||       .|::|:.       |.|:..|...|.::..:|.|:
  Fly   307 ----IIYCIFLMTSMVQVFMVCY-------YGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLL 360

  Fly   342 LARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLL 378
            :.|.|.|..:......|||:.|:..:|..:|....||
  Fly   361 IMRSQKPASIRPPTFPPISLVTYMKVISMSYQFFALL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 46/224 (21%)
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 46/224 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465883
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.