DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19a and Or49b

DIOPT Version :9

Sequence 1:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster


Alignment Length:391 Identity:74/391 - (18%)
Similarity:153/391 - (39%) Gaps:75/391 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FWG----RHYTAYSMVWNVTFHICIWVSFSVNLLQS------NS------LETFCESLCVTMPHT 80
            ||.    ::...|..:...:|||...:.:.::..:.      ||      :.|...:..:...|.
  Fly    17 FWALLYDKNLRRYVCIGLASFHIFTQIVYMMSTNEGLTGIIRNSYMLVLWINTVLRAYLLLADHD 81

  Fly    81 LYM----------LKLINVRRMRGQMISSHWLLRLLDK--RLGCDDERQIIMAGIERAEFIFRTI 133
            .|:          ..|:|        ::..::..:||:  ::|     :::..|         .:
  Fly    82 RYLALIQKLTEAYYDLLN--------LNDSYISEILDQVNKVG-----KLMARG---------NL 124

  Fly   134 FRGLACTVVLGIIYISASSEPTLMYPTWIPWNWRDSTSAY---------LATAMLHTTALMANAT 189
            |.|:..::..| :|..:|||..|.:.:.|| ...:..|.|         |.|.| .....:...:
  Fly   125 FFGMLTSMGFG-LYPLSSSERVLPFGSKIP-GLNEYESPYYEMWYIFQMLITPM-GCCMYIPYTS 186

  Fly   190 LVLNLSSYPGTYLILVSVHTKALALRVSKLG----YGAPLPAVRMQAILVGYIHDHQIILRLFKS 250
            |::.|       ::...|..|||..|:.::.    ||...|. .::..::..|...|.|:.....
  Fly   187 LIVGL-------IMFGIVRCKALQHRLRQVALKHPYGDRDPR-ELREEIIACIRYQQSIIEYMDH 243

  Fly   251 LERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMRFMNMLFLLVILTTETLLLCYTAELPCKEG 315
            :....:|....:..:.:...|.:.:.|:..:......:..:::.:||.....|..|..||. ::.
  Fly   244 INELTTMMFLFELMAFSALLCALLFMLIIVSGTSQLIIVCMYINMILAQILALYWYANELR-EQN 307

  Fly   316 ESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLLNE 380
            .::.||.|...|.:..|..|:.:|.|:.|.|.|..::.|.|.||:::.|..::...||..|:|..
  Fly   308 LAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKR 372

  Fly   381 I 381
            :
  Fly   373 V 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 63/337 (19%)
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 64/344 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465769
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.