DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19a and Or33c

DIOPT Version :9

Sequence 1:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:368 Identity:79/368 - (21%)
Similarity:157/368 - (42%) Gaps:61/368 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VTFHICIWVSFSVNLLQS----NSLETFCESL-----CV--TMPHTLYMLKLINVRRMRGQMISS 99
            |..||.:.:.|.::||..    .|...|.::|     ||  ::.|..::..|       .|::..
  Fly    37 VLLHILVTLWFPLHLLLHLLLLPSTAEFFKNLTMSLTCVACSLKHVAHLYHL-------PQIVEI 94

  Fly   100 HWLLRLLDKRLGCDDERQIIMAGIE-RAEFIFRTIFRGLACTVVLGIIY-----------ISASS 152
            ..|:..||..:..:.|.:.....:. .|....|.::      :..|:||           ||.:.
  Fly    95 ESLIEQLDTFIASEQEHRYYRDHVHCHARRFTRCLY------ISFGMIYALFLFGVFVQVISGNW 153

  Fly   153 EPTLMYPTWIPWNWRDSTSAYLATAML--HTTALMANATLVLNLSSYPGTYLILVSVHTKALALR 215
            |  |:||.:.|::.  .::.:|....|  ...:::......|...:|....|.|::.|....::|
  Fly   154 E--LLYPAYFPFDL--ESNRFLGAVALGYQVFSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIR 214

  Fly   216 VSKLGYGAPLPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLF- 279
            :.:|||......|..|.:| .||..|::::|....:.|::|....:|........|.|..::|| 
  Fly   215 MGQLGYFDDETVVNHQRLL-DYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFF 278

  Fly   280 -GNVGIMRFMNMLFLLV---ILTTETLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLL 340
             |:.     :::::.||   ::..:....||.|....:|.|.|..|::|..|..||.:.|..||:
  Fly   279 VGDT-----ISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLI 338

  Fly   341 MLARCQIPM-----ILVSGVIVPISMKTFTVMIKGAYTMLTLL 378
            .   .|:.:     |:.:|.::.:::..|...:|.||::..::
  Fly   339 F---TQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 71/337 (21%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 71/337 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468592
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29KC3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26189
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 1 1.000 - - FOG0008557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.