DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19a and Or9a

DIOPT Version :9

Sequence 1:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:422 Identity:94/422 - (22%)
Similarity:149/422 - (35%) Gaps:118/422 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IFRIMGIHPPGKRTFWGRHYTAYSMVWNVTF-HICIWVSF----------------------SVN 59
            ::|.|||.                 :|:.|. :...|::|                      .|:
  Fly    23 VYRCMGID-----------------LWSPTMANDRPWLTFVTMGPLFLFMVPMFLAAHEYITQVS 70

  Fly    60 LLQSNSLETFCESLCVTMPHTLYMLKLINVRRMRGQMISSHWLLRLLDKRLGC-DDERQIIMAGI 123
            ||......||...|      ||....|....|.....:..| :..:|.|.:.. .|.|:||....
  Fly    71 LLSDTLGSTFASML------TLVKFLLFCYHRKEFVGLIYH-IRAILAKEIEVWPDAREIIEVEN 128

  Fly   124 ERAEFIFRTIFR--GL-----ACTVVLGIIYISASSEP-----------------TLMY-PTWIP 163
            :..:.:..|..|  ||     |....:|||..|...:.                 .:.| ||:: 
  Fly   129 QSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQVVMFYVPTYL- 192

  Fly   164 WNWRDSTSAYLATAMLHTTALMANATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYGAPLPAV 228
            ||...|.||.       |.||..::  :|...:|....:..::.|..            ..||||
  Fly   193 WNVMASYSAV-------TMALCVDS--LLFFFTYNVCAIFKIAKHRM------------IHLPAV 236

  Fly   229 RMQAILVGYIHD---HQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFL--LFGNVGIMRFM 288
            ..:..|.|.:..   ||..|::...:........|||||.:|...|.|.:.:  ||.|...:.|:
  Fly   237 GGKEELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYFI 301

  Fly   289 NMLFLLVILTTETLLLCYTAELPCKEGESLLTA-------VYSCNWLSQSVNFRRLLLLMLARCQ 346
            ..:..|:|     .|..|:     |.||::.:|       :|..||...|...:|.||:...|.|
  Fly   302 AFVGSLLI-----ALFIYS-----KCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQ 356

  Fly   347 IPMILVSGVIVPISMKTFTVMIKGAYTMLTLL 378
            .| ..:.|.....||.||:.:::.|.:.:.:|
  Fly   357 RP-CQMKGYFFEASMATFSTIVRSAVSYIMML 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 81/344 (24%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 84/352 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.