DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19a and Or65a

DIOPT Version :9

Sequence 1:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:305 Identity:61/305 - (20%)
Similarity:116/305 - (38%) Gaps:91/305 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ERAEFIFRTIFRGLACT-----VVLGIIYISA----SSEPTLMYPTWIPWNWRDSTS---AYLAT 176
            :|..|:   :|..|..|     ::..:|.||.    .|:....:.:| |:...|.:.   ||:..
  Fly   149 KRLHFL---LFMALIITWFSFLILFMLIKISTPFWIESQTLPFHVSW-PFQLHDPSKHPIAYIII 209

  Fly   177 AMLHTTALM-----------ANATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYGAPLPAVRM 230
            .:..:|.::           ...:|...|:|                ||||      ..:....:
  Fly   210 FVSQSTTMLYFLIWLGVVENMGVSLFFELTS----------------ALRV------LCIELRNL 252

  Fly   231 QAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMRFM-NML--- 291
            |.:.:|   |..:   |::.|.|   ||.|.|.......:|.    .:|....||:.: |.|   
  Fly   253 QELCLG---DEDM---LYRELCR---MTKFHQQIILLTDRCN----HIFNGAFIMQMLINFLLVS 304

  Fly   292 ------------------FLLVILTTETLLLCYT--AELPCKEGESLLTAVYSC---NWLSQSVN 333
                              :::::|.|...|..::  .::..||.|.:..|||..   |..|:|::
  Fly   305 LSLFEVLAAKKNPQVAVEYMIIMLMTLGHLSFWSKFGDMFSKESEQVALAVYEAYDPNVGSKSIH 369

  Fly   334 FRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLL 378
              |.....:.|.|.|:|:.:....|.:::.:..::|..|::||:|
  Fly   370 --RQFCFFIQRAQKPLIMKASPFPPFNLENYMFILKQCYSILTIL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 57/297 (19%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 57/297 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465245
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.