DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19a and Or2a

DIOPT Version :9

Sequence 1:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:390 Identity:110/390 - (28%)
Similarity:187/390 - (47%) Gaps:20/390 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVDSTRALVNHWRIFRIMGI-HPPGKRTFWGRHYTAYSMVWNVTFHICIWVSFSVNLLQSNSLET 68
            |:::..|:..|||::.:.|: .|||..:..   |..||:..|:...:...:|....||.:.::..
  Fly     8 KLNTHSAVYYHWRVWELTGLMRPPGVSSLL---YVVYSITVNLVVTVLFPLSLLARLLFTTNMAG 69

  Fly    69 FCESLCVTMPHTLYMLKLINVRRMRGQMISSHWLLRLLDKR---LGCDDERQIIMAGIERAEFIF 130
            .||:|.:|:...:..||..||..:|.|:.....||||:|.|   :|..:|...:...:..|:..|
  Fly    70 LCENLTITITDIVANLKFANVYMVRKQLHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTF 134

  Fly   131 RTIFRGLACTVVLGIIYISASSEPTLMYPTWIPWNWRDSTSAYLATAMLHTTALMANATLVLNLS 195
            ||..........|..:.:....:..|:||.|...:|..||..|:...:.....|:..|.......
  Fly   135 RTFASIFVFGTTLSCVRVVVRPDRELLYPAWFGVDWMHSTRNYVLINIYQLFGLIVQAIQNCASD 199

  Fly   196 SYPGTYLILVSVHTKALALRVSKLG-------YGAPLPAVRMQAI--LVGYIHDHQIILRLFKSL 251
            |||..:|.|::.|.:||.|||.::|       .|....|.|.:..  |:..|.|...:.||.:.:
  Fly   200 SYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRDLARVHRLREII 264

  Fly   252 ERSLSMTCFLQFFSTACAQCTICYFLLF---GNVGIMRFMNMLFLLVILTTETLLLCYTAELPCK 313
            :|.||:.|..||..:|..|||:....|:   .:......::::|...: |.|..::||..:....
  Fly   265 QRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAV-TLEVFVICYFGDRMRT 328

  Fly   314 EGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLL 378
            :.|:|..|.|.|||:.|...|:|.||..|||.|.|.::.:|..:.:|::||..:::..|::.|||
  Fly   329 QSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLL 393

  Fly   379  378
              Fly   394  393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 90/321 (28%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 90/321 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468580
Domainoid 1 1.000 71 1.000 Domainoid score I16381
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 1 1.000 - - FOG0008557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.