DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19a and Or69a

DIOPT Version :9

Sequence 1:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:376 Identity:75/376 - (19%)
Similarity:147/376 - (39%) Gaps:55/376 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NVTFHICIWVSFSVNLLQSN----------------------SLETFCESLCVTMPHTLYMLKLI 87
            |:...|..|:. :|||:..|                      .|.:....|..|:..||.:.|::
  Fly    35 NLAKRIIFWLG-AVNLVYHNIGCVMYGYFGDGRTKDPIAYLAELASVASMLGFTIVGTLNLWKML 98

  Fly    88 NVRRMRGQMISS-HWLLRLLDKRLGCDDERQIIMAGIERAEFIFRT----IFRGLACTVVLGIIY 147
            :::.....:::. ..|.:|:..|.......|.......|..|||.|    .:..|.   :|.:|.
  Fly    99 SLKTHFENLLNEFEELFQLIKHRAYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLP---ILLMIR 160

  Fly   148 ISASSEPTLMY----PTWIPWNWRDSTSAYLATAMLHTTALMANATLVLNLSSYPGTYLILVSVH 208
            ...|:...|.|    .||.||..:.|...:.|.......:...|..:.:.:......:.|.:.:|
  Fly   161 EHFSNSQQLGYRIQSNTWYPWQVQGSIPGFFAAVACQIFSCQTNMCVNMFIQFLINFFGIQLEIH 225

  Fly   209 TKALALRVSKLGYGAPLPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTI 273
            ...||.::..:....|....:::.::| |   |..:|.|...:.||.:.|..:....:..:.|.:
  Fly   226 FDGLARQLETIDARNPHAKDQLKYLIV-Y---HTKLLNLADRVNRSFNFTFLISLSVSMISNCFL 286

  Fly   274 CYFLLFGNVGIMRFMNMLFLLVILTTETLLLCYTAELPCKEGESL-------LTAVYSCNWLSQS 331
            .:.:...:.| ....::|.||:.:|       |...: |:.|..|       |.|.:..||....
  Fly   287 AFSMTMFDFG-TSLKHLLGLLLFIT-------YNFSM-CRSGTHLILTSGKVLPAAFYNNWYEGD 342

  Fly   332 VNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLLNEIR 382
            :.:||:||:::.|...|.:..:..:.|:|:.|:...:|.:|.|.|.:..::
  Fly   343 LVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFTCVRSLK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 65/322 (20%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 65/324 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.