powered by:
Protein Alignment CG18823 and PTBP3
DIOPT Version :9
Sequence 1: | NP_659571.1 |
Gene: | CG18823 / 59184 |
FlyBaseID: | FBgn0042146 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_011517567.1 |
Gene: | PTBP3 / 9991 |
HGNCID: | 10253 |
Length: | 561 |
Species: | Homo sapiens |
Alignment Length: | 67 |
Identity: | 22/67 - (32%) |
Similarity: | 38/67 - (56%) |
Gaps: | 6/67 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 FRNDIPAPTSPRSRIWVRNLPPC--TRQELVMLCLPFGKILGSLIV--DNEGFIQFARESEATSA 62
|:.|.| |.||...:.:|.: || |..|::.|.|||||:...|:: .::.|::.|.|..|.:.
Human 57 FKRDRP-PCSPSRVLHLRKI-PCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTM 119
Fly 63 ID 64
::
Human 120 VN 121
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1545178at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.