DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18823 and PTB2

DIOPT Version :9

Sequence 1:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_200130.1 Gene:PTB2 / 835399 AraportID:AT5G53180 Length:429 Species:Arabidopsis thaliana


Alignment Length:108 Identity:32/108 - (29%)
Similarity:50/108 - (46%) Gaps:19/108 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TSPRSRI-WVRNLP-PCTRQELVMLCLPFGKILGSL----IVDNEGFIQFARESEATSAIDAL-- 66
            |.|.|:: .:|||| .||.:||:.|..|||.::.:.    ...|:.||:|...::|...|...  
plant    13 TQPPSKVLHLRNLPWECTEEELIELGKPFGTVVNTKCNVGANRNQAFIEFEDLNQAIQMISYYAS 77

  Fly    67 ----DQIVFKSKVLQ-------VSNATFPPIEGGQVLVWYDED 98
                .|:..|:..||       |:|.|...:.|..:||..:.|
plant    78 SSEPAQVRGKTVYLQYSNRQEIVNNKTTADVVGNVLLVTIEGD 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18823NP_659571.1 RRM <9..>79 CDD:223796 25/87 (29%)
RRM_1 16..76 CDD:278504 20/71 (28%)
PTB2NP_200130.1 RRM1_PTBPH1_PTBPH2 16..96 CDD:241130 23/79 (29%)
RRM2_PTBPH1_PTBPH2 110..204 CDD:241135 4/11 (36%)
RRM3_PTBPH1_PTBPH2 243..339 CDD:241134
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545178at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.