DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18823 and Ptbp3

DIOPT Version :9

Sequence 1:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_112636.1 Gene:Ptbp3 / 83515 RGDID:621671 Length:523 Species:Rattus norvegicus


Alignment Length:67 Identity:23/67 - (34%)
Similarity:38/67 - (56%) Gaps:6/67 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FRNDIPAPTSPRSRIWVRNLPPC--TRQELVMLCLPFGKILGSLIV--DNEGFIQFARESEATSA 62
            |:.|.| |.||...:.:|.: ||  |..|::.|.|||||:...|::  .::.|::.|.|..|.:.
  Rat    19 FKGDRP-PCSPSRVLHLRKI-PCDVTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTM 81

  Fly    63 ID 64
            |:
  Rat    82 IN 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18823NP_659571.1 RRM <9..>79 CDD:223796 20/60 (33%)
RRM_1 16..76 CDD:278504 17/53 (32%)
Ptbp3NP_112636.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 3/6 (50%)
hnRNP-L_PTB 28..523 CDD:273733 18/57 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545178at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.