powered by:
Protein Alignment CG18823 and Hnrnpl
DIOPT Version :9
Sequence 1: | NP_659571.1 |
Gene: | CG18823 / 59184 |
FlyBaseID: | FBgn0042146 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006228753.3 |
Gene: | Hnrnpl / 80846 |
RGDID: | 71059 |
Length: | 671 |
Species: | Rattus norvegicus |
Alignment Length: | 35 |
Identity: | 11/35 - (31%) |
Similarity: | 19/35 - (54%) |
Gaps: | 3/35 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 ESEATSAIDALDQIVFKSKVLQVSNATFPPIEGGQ 90
|.|.|..:..| .|:|:::.|..| .||.::.|:
Rat 72 EPEQTQPLKVL-PILFQTRYLPQS--PFPLVKRGR 103
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG18823 | NP_659571.1 |
RRM |
<9..>79 |
CDD:223796 |
7/22 (32%) |
RRM_1 |
16..76 |
CDD:278504 |
6/19 (32%) |
Hnrnpl | XP_006228753.3 |
hnRNP-L_PTB |
145..669 |
CDD:273733 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1545178at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.