DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18823 and hnrnpl2

DIOPT Version :9

Sequence 1:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_005169749.1 Gene:hnrnpl2 / 573096 ZFINID:ZDB-GENE-040426-2707 Length:522 Species:Danio rerio


Alignment Length:34 Identity:10/34 - (29%)
Similarity:15/34 - (44%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KILGSLIVDNEGFIQFARESEATSAIDALDQIVF 71
            |.|.||:|...|.:....||:...|:.....|.:
Zfish    37 KTLPSLVVHVRGLVDGVLESDIVEALQEFGTISY 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18823NP_659571.1 RRM <9..>79 CDD:223796 10/34 (29%)
RRM_1 16..76 CDD:278504 10/34 (29%)
hnrnpl2XP_005169749.1 hnRNP-L_PTB 40..520 CDD:273733 8/31 (26%)
RRM1_hnRNPL 40..119 CDD:241224 8/31 (26%)
RRM2_hnRNPL 129..228 CDD:241229
RRM3_hnRNPL 313..386 CDD:241143
RRM_SF 429..515 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545178at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.