DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18823 and PTBP1

DIOPT Version :9

Sequence 1:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_005259654.1 Gene:PTBP1 / 5725 HGNCID:9583 Length:559 Species:Homo sapiens


Alignment Length:66 Identity:21/66 - (31%)
Similarity:34/66 - (51%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FRNDIPAPTSPRSRIWVRNLP-PCTRQELVMLCLPFGKILGSLIV--DNEGFIQFARESEATSAI 63
            |:.|..:...|...|.:|.|| ..|..|::.|.|||||:...|::  .|:.||:...|..|.:.:
Human    49 FKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMV 113

  Fly    64 D 64
            :
Human   114 N 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18823NP_659571.1 RRM <9..>79 CDD:223796 19/59 (32%)
RRM_1 16..76 CDD:278504 18/52 (35%)
PTBP1XP_005259654.1 hnRNP-L_PTB 59..559 CDD:273733 19/56 (34%)
RRM1_PTBP1 61..141 CDD:241221 18/54 (33%)
RRM2_PTBP1_like 183..278 CDD:241137
RRM3_PTBP1 366..458 CDD:241139
RRM_SF 479..559 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545178at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.