DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18823 and ncoa5

DIOPT Version :9

Sequence 1:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_005166217.1 Gene:ncoa5 / 447849 ZFINID:ZDB-GENE-040912-155 Length:622 Species:Danio rerio


Alignment Length:90 Identity:27/90 - (30%)
Similarity:43/90 - (47%) Gaps:11/90 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RNDIPAPT------SPRS---RIWVRNLPPC--TRQELVMLCLPFGKILGSLIVDNEGFIQFARE 56
            |:..|.|:      .||.   ||:|.|||..  .::::..|..|:|||....:....||:||.|.
Zfish     7 RSATPPPSYVTNSNDPRDLERRIFVGNLPTAHMAKKDMEDLFRPYGKIQALSLFRGYGFVQFERL 71

  Fly    57 SEATSAIDALDQIVFKSKVLQVSNA 81
            .:|.:|....:..|::...|.|:.|
Zfish    72 EDAEAAKAGHNGRVYRGYKLDVNMA 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18823NP_659571.1 RRM <9..>79 CDD:223796 23/80 (29%)
RRM_1 16..76 CDD:278504 18/61 (30%)
ncoa5XP_005166217.1 RRM <1..168 CDD:223796 27/90 (30%)
RRM_hnRNPC_like 27..94 CDD:240787 20/66 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D421126at33208
OrthoFinder 1 1.000 - - FOG0006056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.