powered by:
Protein Alignment CG18823 and hnrnpl
DIOPT Version :9
Sequence 1: | NP_659571.1 |
Gene: | CG18823 / 59184 |
FlyBaseID: | FBgn0042146 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_957393.1 |
Gene: | hnrnpl / 394074 |
ZFINID: | ZDB-GENE-040426-710 |
Length: | 536 |
Species: | Danio rerio |
Alignment Length: | 65 |
Identity: | 19/65 - (29%) |
Similarity: | 29/65 - (44%) |
Gaps: | 8/65 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 NDIPAPTSPRSRIWVRNL-PPCTRQELVMLCLPFGKILGSLIV----DNEGFIQFARESEATSAI 63
|| |..|.|...:.||.| ...|..:||.....||.| |.:| ..:..::|...:.|::|:
Zfish 32 ND-PHKTLPSLVVHVRGLIDGITEADLVEALQEFGTI--SYVVLMPKKRQALVEFEDMNGASNAV 93
Fly 64 63
Zfish 94 93
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1545178at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.