DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18823 and hrpl-1

DIOPT Version :9

Sequence 1:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001379559.1 Gene:hrpl-1 / 3565706 WormBaseID:WBGene00016624 Length:597 Species:Caenorhabditis elegans


Alignment Length:132 Identity:32/132 - (24%)
Similarity:50/132 - (37%) Gaps:43/132 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RNDIPAPTSPRSRI--WVRNL-PPCTRQELV-----------MLCLPFGKILGSLIVDNEG---F 50
            |:|...||:|...|  .|||| ...|..:|:           ..|:|..::......|.||   .
 Worm    19 RDDNADPTNPNPSIVVHVRNLHQKVTEADLLEALSNFGPVAYATCIPHSRMALVEFEDIEGAKAC 83

  Fly    51 IQFARESEAT----------SAIDALDQIVFKS----KVLQVS--NATFPPIEGGQVLVWYDEDG 99
            :.||..::..          |....::::.|:|    |||.|:  ||.:|          .|.|.
 Worm    84 VNFATSNQINVGGQGALFNYSTSQCIERMGFESATPNKVLVVTVLNAQYP----------IDADV 138

  Fly   100 VY 101
            :|
 Worm   139 IY 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18823NP_659571.1 RRM <9..>79 CDD:223796 23/100 (23%)
RRM_1 16..76 CDD:278504 18/90 (20%)
hrpl-1NP_001379559.1 hnRNP-L_PTB 30..514 CDD:273733 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545178at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.