powered by:
Protein Alignment CG18823 and ptbp1b
DIOPT Version :9
Sequence 1: | NP_659571.1 |
Gene: | CG18823 / 59184 |
FlyBaseID: | FBgn0042146 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001116126.1 |
Gene: | ptbp1b / 321220 |
ZFINID: | ZDB-GENE-030131-9796 |
Length: | 564 |
Species: | Danio rerio |
Alignment Length: | 65 |
Identity: | 22/65 - (33%) |
Similarity: | 34/65 - (52%) |
Gaps: | 3/65 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 FRNDIPAPTSPRSRIWVRNLP-PCTRQELVMLCLPFGKILGSLIV--DNEGFIQFARESEATSAI 63
|:.||.:|..|...|.||.|| .....|::.|.|||||:...|:: .|:.|::...|..|.:.:
Zfish 59 FKGDIRSPAVPSRVIHVRKLPNDINEAEVIALGLPFGKVTNLLMLKGKNQAFLEMNSEEAAQTMV 123
Fly 64 63
Zfish 124 123
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1545178at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.