DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18823 and Hnrnpc

DIOPT Version :10

Sequence 1:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001264529.1 Gene:Hnrnpc / 290046 RGDID:1309982 Length:313 Species:Rattus norvegicus


Alignment Length:84 Identity:21/84 - (25%)
Similarity:41/84 - (48%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PTSPRSRIWVRNLPPCT--RQELVMLCLPFGKILGSLIVDNEGFIQFARESEATSAIDALDQIVF 71
            |.|..||:::.||....  :.::..:...:|||:|..:.....|:|:..|..|.:|:...|..:.
  Rat    11 PRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMI 75

  Fly    72 KSKVLQVSNATFPPIEGGQ 90
            ..:||.::.|..|.:..|:
  Rat    76 AGQVLDINLAAEPKVNRGK 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18823NP_659571.1 RRM_1 16..76 CDD:425453 12/61 (20%)
HnrnpcNP_001264529.1 RRM_hnRNPC 10..93 CDD:410015 20/81 (25%)

Return to query results.
Submit another query.