DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18823 and RBM20

DIOPT Version :9

Sequence 1:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001127835.2 Gene:RBM20 / 282996 HGNCID:27424 Length:1227 Species:Homo sapiens


Alignment Length:113 Identity:27/113 - (23%)
Similarity:46/113 - (40%) Gaps:38/113 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IPA-------PTSPRSR--------------IWVRNLP--PCTRQELVMLCLPFGKILGSLIV-- 45
            |||       ||.|.:.              :.:.|||  .||..:::.|.|||||:...:::  
Human   489 IPARSFTQSSPTFPLASVGTTFAQRKGAGRVVHICNLPEGSCTENDVINLGLPFGKVTNYILMKS 553

  Fly    46 DNEGFIQFARESEATSAIDALDQIVFKSKVLQVSNATFPPIEGGQVLV 93
            .|:.|::.|....|.:.:....:   ||.|          |.|.::|:
Human   554 TNQAFLEMAYTEAAQAMVQYYQE---KSAV----------INGEKLLI 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18823NP_659571.1 RRM <9..>79 CDD:223796 21/87 (24%)
RRM_1 16..76 CDD:278504 17/63 (27%)
RBM20NP_001127835.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..374
RRM_RBM20 518..593 CDD:241129 21/84 (25%)
DUF1777 612..>706 CDD:285811
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 624..905
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 974..1089
ZnF_U1 1159..1193 CDD:197732
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1201..1227
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545178at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.