DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18823 and ptb-1

DIOPT Version :9

Sequence 1:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_741041.1 Gene:ptb-1 / 174647 WormBaseID:WBGene00004207 Length:615 Species:Caenorhabditis elegans


Alignment Length:71 Identity:19/71 - (26%)
Similarity:39/71 - (54%) Gaps:5/71 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NDIPAPTS-PRSR-IWVRNLPP-CTRQELVMLCLPFGKILGSLIV--DNEGFIQFARESEATSAI 63
            |...|.|| |.|: :.|||:|| ....||:.||:.:|.:...:::  .::.|:::..|:.|.:.:
 Worm   109 NSTSAVTSIPVSKVVHVRNIPPDLVDVELMQLCIQYGPVSNYMMLKGKSQAFVEYEEEASAAAFV 173

  Fly    64 DALDQI 69
            ..:..:
 Worm   174 SGMTAV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18823NP_659571.1 RRM <9..>79 CDD:223796 17/66 (26%)
RRM_1 16..76 CDD:278504 13/57 (23%)
ptb-1NP_741041.1 hnRNP-L_PTB 119..615 CDD:273733 14/61 (23%)
RRM1_PTBP1_hnRNPL_like 122..195 CDD:240867 13/58 (22%)
RRM2_PTBP1_like 229..324 CDD:241137
RRM3_PTBP1_like 422..495 CDD:240869
RRM4_PTBP1_like 539..613 CDD:240871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545178at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.