powered by:
Protein Alignment CG18823 and ptb-1
DIOPT Version :9
Sequence 1: | NP_659571.1 |
Gene: | CG18823 / 59184 |
FlyBaseID: | FBgn0042146 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_741041.1 |
Gene: | ptb-1 / 174647 |
WormBaseID: | WBGene00004207 |
Length: | 615 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 19/71 - (26%) |
Similarity: | 39/71 - (54%) |
Gaps: | 5/71 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 NDIPAPTS-PRSR-IWVRNLPP-CTRQELVMLCLPFGKILGSLIV--DNEGFIQFARESEATSAI 63
|...|.|| |.|: :.|||:|| ....||:.||:.:|.:...::: .::.|:::..|:.|.:.:
Worm 109 NSTSAVTSIPVSKVVHVRNIPPDLVDVELMQLCIQYGPVSNYMMLKGKSQAFVEYEEEASAAAFV 173
Fly 64 DALDQI 69
..:..:
Worm 174 SGMTAV 179
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1545178at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.