DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18823 and Neos

DIOPT Version :10

Sequence 1:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_308182.5 Gene:Neos / 1269540 VectorBaseID:AGAMI1_009133 Length:429 Species:Anopheles gambiae


Alignment Length:69 Identity:21/69 - (30%)
Similarity:33/69 - (47%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SRIWVRNLPPCTR-QELVMLCLPFGKILGSLIVDNEGFIQFARESEATSAIDALDQIVFKSKVLQ 77
            ||::|..|....: :|...|...|.......::...|||||..|..|::||.|::..:|..:.|.
Mosquito     9 SRVYVGGLGEQAKVEEFEELFKDFQPYQDLTLLRGFGFIQFHSEKAASAAIKAMNGKLFNGRKLM 73

  Fly    78 VSNA 81
            |..|
Mosquito    74 VKVA 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18823NP_659571.1 RRM_1 16..76 CDD:425453 16/60 (27%)
NeosXP_308182.5 None

Return to query results.
Submit another query.