DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18823 and ptbp3

DIOPT Version :9

Sequence 1:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_012811881.1 Gene:ptbp3 / 100145652 XenbaseID:XB-GENE-988703 Length:530 Species:Xenopus tropicalis


Alignment Length:132 Identity:30/132 - (22%)
Similarity:49/132 - (37%) Gaps:45/132 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FRNDIPAPTSPRSRIWVRNLP-PCTRQELVMLCLPFGKILGSLIV--DNEGFIQFARESEATSAI 63
            |:.| .:|.||...:.:|.:| ..|..|::.|.|||||:...|::  .::.|::.|.|..|.|.:
 Frog    28 FKGD-RSPCSPSRVLHIRKIPNDVTESEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVSMV 91

  Fly    64 D-------------------------------------ALDQIVFKSKVLQVSNATFPPIEGGQV 91
            :                                     ||..:    ..||....|...:.||:.
 Frog    92 NYYTPVPPHVRSQPVYIQYSNHRELKTDNLPNQARAQAALQAV----NTLQSGGLTLTSVPGGEG 152

  Fly    92 LV 93
            ||
 Frog   153 LV 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18823NP_659571.1 RRM <9..>79 CDD:223796 23/109 (21%)
RRM_1 16..76 CDD:278504 18/99 (18%)
ptbp3XP_012811881.1 hnRNP-L_PTB 37..530 CDD:273733 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545178at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.