DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18823 and hnrnpl

DIOPT Version :9

Sequence 1:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001093751.1 Gene:hnrnpl / 100101795 XenbaseID:XB-GENE-491581 Length:538 Species:Xenopus tropicalis


Alignment Length:71 Identity:16/71 - (22%)
Similarity:29/71 - (40%) Gaps:9/71 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PRSRIWVRNLPP-CTRQELVMLCLPFG-------KIL-GSLIVDNEGFIQFARESEATSAIDALD 67
            |.|.:...|.|| .|.:..:.:|...|       ||. |.....:.|.:::..:|||...:..::
 Frog   449 PSSVLHFFNAPPEVTEENFIEMCDELGVKKPASIKIFSGKSERSSSGLLEWDSKSEALETLGLMN 513

  Fly    68 QIVFKS 73
            ....|:
 Frog   514 HYQMKN 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18823NP_659571.1 RRM <9..>79 CDD:223796 16/71 (23%)
RRM_1 16..76 CDD:278504 14/67 (21%)
hnrnplNP_001093751.1 hnRNP-L_PTB 49..536 CDD:273733 16/71 (23%)
RRM1_hnRNPL 49..128 CDD:241224
RRM2_hnRNPL 139..238 CDD:241229
Gly-rich_Ago1 268..>309 CDD:289530
RRM3_hnRNPL 333..406 CDD:241143
RRM_SF 449..531 CDD:302621 16/71 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545178at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.