DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and CD53

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_000551.1 Gene:CD53 / 963 HGNCID:1686 Length:219 Species:Homo sapiens


Alignment Length:216 Identity:61/216 - (28%)
Similarity:114/216 - (52%) Gaps:22/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILLISWF 69
            :.::||:||.||||..|||..::.||..|... .|.......|.:..:....:|:|:||:::::.
Human     6 LKLLKYVLFFFNLLFWICGCCILGFGIYLLIH-NNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFL 69

  Fly    70 GCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMG----DVVEKAWNHRTSRSD 130
            ||.|:|:|:.|:.|::.|||.::::.::.|.|.::|.:.|..|.:.    |.:.:..:..::::.
Human    70 GCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAA 134

  Fly   131 YMDAIQISMKCCGRSGYTDYAYQGKFPPSCCSDTNNCRWETVYRRGCKVTFVEFWDRNSDIIKYA 195
            : |:||..::|||.:|.:|:. .|. |.||.||..        ..||... ...|..::.:  |.
Human   135 W-DSIQSFLQCCGINGTSDWT-SGP-PASCPSDRK--------VEGCYAK-ARLWFHSNFL--YI 185

  Fly   196 GLV---IAAIEFVGFVFACCL 213
            |::   :..||.:|..||..|
Human   186 GIITICVCVIEVLGMSFALTL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 61/213 (29%)
tetraspanin_LEL 104..188 CDD:239401 21/87 (24%)
CD53NP_000551.1 Tetraspannin 9..206 CDD:366035 60/211 (28%)
CD53_like_LEL 104..186 CDD:239417 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.