DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and CD9

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_005253871.1 Gene:CD9 / 928 HGNCID:1709 Length:249 Species:Homo sapiens


Alignment Length:217 Identity:46/217 - (21%)
Similarity:95/217 - (43%) Gaps:33/217 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQV----------PVTMII 58
            |...:||:||.||.:..:.||.::..|..|     ..|...:::..|:.          ...:|.
Human     6 GTKCIKYLLFGFNFIFWLAGIAVLAIGLWL-----RFDSQTKSIFEQETNNNNSSFYTGVYILIG 65

  Fly    59 LGTIILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWN 123
            .|.:::|:.:.|||||::||.||...:...|.|:...::|..|:.:..||:.::.:.:..:..:|
Human    66 AGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYN 130

  Fly   124 HRTSRS----DYMDAIQISMKCCGRSGYTDY-----AYQGKFPPSCCSDTNNCRWETV---YRRG 176
            ...::.    :.:.||..::...|:.....:     |::....|..|..:|  |..|:   :...
Human   131 KLKTKDEPQRETLKAIHYAVCRLGKDTLLRFLRIVSAHRVLTAPDQCKHSN--RLLTICFSHPHP 193

  Fly   177 CKVTFVEF----WDRNSDIIKY 194
            |.:..||.    |.|.:..:::
Human   194 CLLAVVELLWFGWGRGTVYLRH 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 45/213 (21%)
tetraspanin_LEL 104..188 CDD:239401 16/99 (16%)
CD9XP_005253871.1 Tetraspannin 9..>147 CDD:278750 32/142 (23%)
tetraspanin_LEL 111..>149 CDD:243179 5/37 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.