DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and TET10

DIOPT Version :10

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_176515.3 Gene:TET10 / 842632 AraportID:AT1G63260 Length:284 Species:Arabidopsis thaliana


Alignment Length:102 Identity:26/102 - (25%)
Similarity:47/102 - (46%) Gaps:8/102 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILLISW 68
            |:....:::...|||..:..:.:|:||..:.:.    :|...  |:...||  |.||..|.|||.
plant     2 GMGTSTFVIRWVNLLTMLLAVAVIIFGVWMSTH----NDGCR--RSLTFPV--IALGGFIFLISI 58

  Fly    69 FGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWV 105
            .|..||.:.|..:...|..:|.:::|..|...:..::
plant    59 IGFLGACKRSVALLWIYLAVLLIVLIAILVFTVLAFI 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspanin 8..215 CDD:459767 25/98 (26%)
TET10NP_176515.3 Tetraspanin 8..>137 CDD:459767 25/96 (26%)

Return to query results.
Submit another query.