DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tspan2

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_072111.1 Gene:Tspan2 / 64521 RGDID:620982 Length:221 Species:Rattus norvegicus


Alignment Length:237 Identity:59/237 - (24%)
Similarity:106/237 - (44%) Gaps:44/237 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDF-AEALRTQQVPVTMIIL---GTIIL 64
            |:..:||:|..||||..:.|..:|.|| |.|.....:.|. :|....:...|.:.:|   |.:::
  Rat     7 GLRCIKYLLLGFNLLFWLAGSAVIAFG-LWFRFGGTIKDLSSEEKSPEYFYVGLYVLVGAGALMM 70

  Fly    65 LISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWNHRTSRS 129
            .:.:||||||:|||.|:..::...|.|:...::...::.::.||..:..:..:.|:|:      |
  Rat    71 AVGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKDVAIRHVQSMYEEAY------S 129

  Fly   130 DY----------MDAIQISMKCCGRSGYTDYAYQGKFPPSCCSDT---NNC--RWETVYRRGCKV 179
            ||          :.....:.:|||:..      ..:..|:|..:.   .||  :.||:.  ..|:
  Rat   130 DYVRDRGRGNGTLITFHSAFQCCGKES------SEQVQPTCPKELPGHKNCIDKIETII--SVKL 186

  Fly   180 TFVEFWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIRNYR 221
                      .:|...|:.||.:...|.:|:..|..:|||.|
  Rat   187 ----------QLIGIVGIGIAGLTIFGMIFSMVLCCAIRNSR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 54/227 (24%)
tetraspanin_LEL 104..188 CDD:239401 17/98 (17%)
Tspan2NP_072111.1 Tetraspannin 10..214 CDD:278750 54/228 (24%)
CD81_like_LEL 110..186 CDD:239404 16/89 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.