DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and cd81a

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_571593.2 Gene:cd81a / 58031 ZFINID:ZDB-GENE-000831-5 Length:236 Species:Danio rerio


Alignment Length:240 Identity:60/240 - (25%)
Similarity:109/240 - (45%) Gaps:29/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCGI----SMVKYILFIFNLLCSICGILLIVFGALLF----SKVRNMDDF----AEALRTQQVP 53
            |..|:    ..:||:||.||.:..:.|  .::.|..|:    :|..::.|.    .|:..|..:.
Zfish     1 MGVGVEGCTKCIKYMLFFFNFIFWLAG--CVILGVSLWLRHDTKTSSLLDLKYEGTESPTTFYIS 63

  Fly    54 VTMII-LGTIILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKY-LEIMG- 115
            |.::| :|.:::.:.:.||.|||:||.|:..|:...|.:|...::|..|:.::.|||. .|::| 
Zfish    64 VYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFACLVLLFACEVAAGIWGFMNKDKISKEVIGF 128

  Fly   116 --DVVEKAWNHRTSRSDYMDAI----QISMKCCGRSGYTDYAYQGKFPPSCCSDTNNCRWETVYR 174
              .|.:|...:.|...:...|:    ..:::|||: |....|...::....|.:  :.|...|  
Zfish   129 YDSVYDKGATYNTDNKNPATAVLKVFHETLQCCGK-GNLFTAIVDRWLTDTCPE--HLRTNAV-- 188

  Fly   175 RGCKVTFVEFWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIRN 219
             .|.......:.....:|..|.||:|.|.....:|:..|...|||
Zfish   189 -DCHTEIKNLFTDKISLIGIAALVVAVIMIFEMIFSMVLCCGIRN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 55/225 (24%)
tetraspanin_LEL 104..188 CDD:239401 18/91 (20%)
cd81aNP_571593.2 Tetraspannin 11..230 CDD:278750 55/226 (24%)
CD81_like_LEL 115..202 CDD:239404 18/92 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.