DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and tspan37

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001292501.1 Gene:tspan37 / 564334 ZFINID:ZDB-GENE-070912-550 Length:245 Species:Danio rerio


Alignment Length:238 Identity:56/238 - (23%)
Similarity:90/238 - (37%) Gaps:58/238 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILLISWFGCCGA 74
            |.||..||......:|.:|.||:||                       |.|:|       ||..:
Zfish    39 YGLFFSNLYIIFPALLAVVSGAILF-----------------------ITGSI-------GCLVS 73

  Fly    75 IRESYCMS--MTYSILLFVLMIGQLALVIYMWVQK-DKYLEIMGDVVEKAWNHRTSRSD----YM 132
            .::..|..  ..|.:::...::|..|.:.|.:..| |..|..:.||.:   |:..:..|    .:
Zfish    74 SKKPSCGHGLFVYFLIIVFCVVGTTAALAYFYQGKLDAELAPLKDVFQ---NYSNNSQDPDTKAV 135

  Fly   133 DAIQISMKCCGRSGYTD------YAYQGKF--PPSCCSDT-NNCRWE-----TVYRRGCKVTFVE 183
            |.:|..::|||...|||      :.:.||:  |.|||:.| ::|...     .:|...|:|...|
Zfish   136 DRLQSELQCCGVMNYTDWLQTPWFNHSGKYDVPQSCCNTTFHSCNGTLDAPMLLYNEACQVKLKE 200

  Fly   184 FWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIRNYRRRAEY 226
            .......||....||:..:    .|.:......:..|....||
Zfish   201 LLLLVVHIIHITSLVVLVL----LVLSWITVGQLMRYPVPQEY 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 53/227 (23%)
tetraspanin_LEL 104..188 CDD:239401 27/102 (26%)
tspan37NP_001292501.1 Tetraspannin 14..194 CDD:278750 45/187 (24%)
TM4SF8_like_LEL 102..195 CDD:239416 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.