DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tspan5

DIOPT Version :10

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_006501799.1 Gene:Tspan5 / 56224 MGIID:1928096 Length:311 Species:Mus musculus


Alignment Length:102 Identity:23/102 - (22%)
Similarity:32/102 - (31%) Gaps:41/102 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 RESAARAAPPQTPPPPAPP------------------------RFQKSHSETQFTNAASSS---- 449
            ||:..|..||..||||.||                        .|.|..:|..::..:..|    
Mouse    95 REAVGRETPPLPPPPPLPPSVEDDWDGPAIGPPASLLSSASSDEFCKEKTEDCYSLGSLDSGMRT 159

  Fly   450 ------------TQLAQPAQDDDEPK-AHTPRMLKRI 473
                        .:|..|.:.|...| .|.|.::|.|
Mouse   160 PLCRICFQGPEQGELLSPCRCDGSVKCTHQPCLIKWI 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspanin 8..215 CDD:459767
Tspan5XP_006501799.1 Tetraspanin 72..301 CDD:459767 23/102 (23%)
TM4SF9_like_LEL 156..276 CDD:239412 8/41 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.