DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and tspan9a

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_009291748.1 Gene:tspan9a / 555341 ZFINID:ZDB-GENE-060503-632 Length:336 Species:Danio rerio


Alignment Length:245 Identity:65/245 - (26%)
Similarity:115/245 - (46%) Gaps:42/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILLISWFGCC 72
            :||::|:|||:..:||..|:..|..|.....:...|:.:..:......:|.:|.|:::..:.||.
Zfish   106 LKYMMFVFNLIFWLCGCGLLGVGIWLSVSQGSFATFSPSFPSLSAANMVIAIGAIVMVTGFLGCL 170

  Fly    73 GAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLE-IMGDV--------------VEKAW 122
            |||:|:.|:.:::.|:|.::::.:|.|:|..:|..||..| ...|:              :..||
Zfish   171 GAIKENKCLLLSFFIVLLIILLAELILLILFFVYSDKVSENAKQDLKDGLALYNTDNNIGLRNAW 235

  Fly   123 NHRTSRSDYMDAIQISMKCCGRSGYTDY--AYQGK-FPPSCCSD--------TNNCRWETVYRRG 176
            |          .||...||||.:||||:  |.:.| .|..||.:        :.|..|    .||
Zfish   236 N----------IIQAEWKCCGVTGYTDWHDALKEKVVPDRCCQEHYQECGRNSTNMFW----TRG 286

  Fly   177 CKVTFVEFWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIRNYRRRAEY 226
            |.....|:.:.|..::...|:.|..::.:|..|:..|.:.|  :|...:|
Zfish   287 CYEKVEEWLEDNKHLLGTIGMCILVVQLLGMAFSMTLFHQI--HRSGKKY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 62/234 (26%)
tetraspanin_LEL 104..188 CDD:239401 29/109 (27%)
tspan9aXP_009291748.1 Tetraspannin 105..327 CDD:278750 62/234 (26%)
NET-5_like_LEL 202..299 CDD:239418 29/110 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.