DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and cd81b

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001003735.1 Gene:cd81b / 445280 ZFINID:ZDB-GENE-040808-52 Length:238 Species:Danio rerio


Alignment Length:237 Identity:55/237 - (23%)
Similarity:99/237 - (41%) Gaps:37/237 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQ----QVPVT-------MIILGT 61
            :||:||..|.:..:.|  .::.|..|:  :|:....:..|..|    |.|.|       :|.:|.
Zfish    10 IKYMLFFLNFIFWLAG--GVILGVALW--LRHDSQTSNLLMLQFEGNQAPGTFYISVYVLIAIGA 70

  Fly    62 IILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAW---- 122
            |::.:.:.||.|||:||.|:..|:...|.:|...::|..|:.::.:|.....:.:..:.|:    
Zfish    71 IMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFINRDTISTELINFYDAAYIKAV 135

  Fly   123 -----NHRTSRSDYMDAIQISMKCCGRSGYTDYAYQGKFPPSCCSDTNNCRWET-----VYRRGC 177
                 ..|.:.|..::....::.|||:....|...        ...|:.|..:|     :..:.|
Zfish   136 DPVDTTSRQTASKVLEVFHDNLDCCGKGDDNDLFK--------VVQTSLCPKKTFPLDPLISQSC 192

  Fly   178 KVTFVEFWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIRN 219
            .|.....:.....:|..|.||||.|.....:|...|..:|||
Zfish   193 HVKLRNLFSEKLHVIGLAALVIAVIMVFEMIFTMVLCCAIRN 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 52/233 (22%)
tetraspanin_LEL 104..188 CDD:239401 13/97 (13%)
cd81bNP_001003735.1 Tetraspannin 9..232 CDD:278750 52/233 (22%)
CD81_like_LEL 113..204 CDD:239404 13/98 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.