DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tsp96F

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:268 Identity:65/268 - (24%)
Similarity:114/268 - (42%) Gaps:56/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SMVKYILFIFNLLCSICGILLIVFG-------ALLFSKVRNMDDFAEALRTQQVPVTMIILGTII 63
            |.|||::.:.|:|..:.|:.::|..       ..:.|..:|.:.:..||      ...:.:|.:|
  Fly     8 SCVKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNHYHIAL------YVFLAIGILI 66

  Fly    64 LLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVV------EKAW 122
            .|.::|||||..|||.|:.:::..::.::|:.|:|...:.:..|||..:|:...|      |...
  Fly    67 TLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQ 131

  Fly   123 NHRTSRSDYMDAIQISMKCCGRSGYTDYAYQGKF----------------------PPSCCSDT- 164
            :..:||:...|.:|.::||||..|..|:| ..:|                      |.|||.|. 
  Fly   132 STMSSRTVTFDTLQKNLKCCGADGPGDWA-TSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNL 195

  Fly   165 --NNCRW-----------ETVYRRGCKVTFVEFWDRNSDIIKYAGLVIAAIEFVGFVFACCLANS 216
              |.|..           ..:|::||....:|....|...|......:..:|.:...||..|..:
  Fly   196 KDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCCA 260

  Fly   217 IRNYRRRA 224
            :||...:|
  Fly   261 VRNQHYKA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 61/257 (24%)
tetraspanin_LEL 104..188 CDD:239401 29/125 (23%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 61/258 (24%)
CD151_like_LEL 107..233 CDD:239408 29/126 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443044
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.