DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tsp66E

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:286 Identity:72/286 - (25%)
Similarity:114/286 - (39%) Gaps:94/286 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CGISMVKYILFIFNLLCSICGILLIVFGALLFSKV--------------RNMDDFAEALRTQQVP 53
            ||:...||:|.|||.:..:.|  .|:||..|:..|              ..::.|.:....:|:.
  Fly     5 CGVWCAKYLLCIFNFIFFVLG--TIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLA 67

  Fly    54 VTMIILGTIILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDK-------YL 111
            ..::::|.::..:|:.|..||:|||.|:..||...|.:|:|.::.........|||       :|
  Fly    68 YVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFL 132

  Fly   112 EI------MGDVVEKA---WNHRTSRSDYMDAIQISMKCCGRSGYTDYA-----YQGK----FPP 158
            :.      :|:.|:..   ||.          :..:..|||.:.|.|:.     ..||    .|.
  Fly   133 QTTITSYSLGENVDATSLMWNQ----------LMGNFGCCGINDYHDFDASPAWVNGKGNRTIPD 187

  Fly   159 SCC-------------------SDTNNCRWETVYRRGCKVTFVEFWDRNSDIIKYAGLVIAAIEF 204
            :||                   ||:|     :.|::||...|.| |     :|:...|||.||. 
  Fly   188 ACCILKDVAKLVPRDEDCTTNPSDSN-----SFYKKGCYEVFTE-W-----LIRQRELVIVAIA- 240

  Fly   205 VGFV--------FACCLA----NSIR 218
            ||.|        ||.|.|    |.:|
  Fly   241 VGIVHLVLIILAFALCKAFAKYNDMR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 69/278 (25%)
tetraspanin_LEL 104..188 CDD:239401 27/127 (21%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 67/272 (25%)
uroplakin_I_like_LEL 116..231 CDD:239409 28/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442979
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.