DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and tspan2a

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001018160.1 Gene:tspan2a / 378854 ZFINID:ZDB-GENE-050522-511 Length:211 Species:Danio rerio


Alignment Length:234 Identity:58/234 - (24%)
Similarity:105/234 - (44%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVP----VTMIIL-- 59
            |.|    |||:||:||.:..:.|.|::..|..|    |...|....|.....|    :.:.||  
Zfish     8 MKC----VKYLLFVFNFIFWLSGSLVLAVGLWL----RFDPDTTSLLSENDAPENFFIAVYILIG 64

  Fly    60 -GTIILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWN 123
             |.|::::.:|||.||:|||.|:..::...|.::...::|..::.::.||:       ::::..|
Zfish    65 AGGIMMIVGFFGCFGAVRESQCLLGSFFACLLLIFGAEVAAGVFGFLNKDQ-------IIKEVQN 122

  Fly   124 HRTSRSDYMDAIQIS------MKCCGRSGYTDYAYQGKFPPSCCSDTNNCRWETVYRRGCKVTFV 182
            :..|.:...:...|:      :.|||..         ..|...|::.|         :.|.....
Zfish   123 YYESATKMENGTVITSAFHSVLDCCGTE---------SSPIETCTEGN---------KDCVQAIE 169

  Fly   183 EFWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIRNYR 221
            :|::....||.|.|:.||.:..:|.:|:..|..:|||.|
Zfish   170 DFFNEKLFIIGYVGIGIAGVMVIGMIFSMVLCCAIRNSR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 52/221 (24%)
tetraspanin_LEL 104..188 CDD:239401 13/89 (15%)
tspan2aNP_001018160.1 Tetraspannin 10..204 CDD:278750 53/226 (23%)
tetraspanin_LEL 110..176 CDD:243179 13/90 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.