DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and TM4SF

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:223 Identity:50/223 - (22%)
Similarity:91/223 - (40%) Gaps:42/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISMVKYILFIFNLLCSICGILLIVFGALL-------FSKVRNMDDFAEALRTQQVPVTMIILGTI 62
            |...||:::.:.:|.::.|...|..|..|       :..|:|        :.......::.||.:
  Fly     7 IKCFKYLVYSYVVLLALTGAAQIFLGTSLLWGHSVYYGIVQN--------KLWAPAAILLCLGPV 63

  Fly    63 ILLISWFGCCGAIRESYCMSMTYSILL-------FVLMIGQLAL------VIYMWVQKDKYLEIM 114
            ..::.|.||....:...|:...::.||       |::....||:      .:.:::. |.::|.:
  Fly    64 TFILCWMGCQATNQRKRCLLGMFAALLVACICVQFIICGWSLAMRENLPTSVEIFID-DSFVEFL 127

  Fly   115 GDVVEKAWNHRTSRSDYMDAIQISMKCCGRSGYTDYAYQGKFPPSCCSDTNN-----CRWETVYR 174
                :|....:.......:.:|..::|||..|..||. :...|.||||...:     |  :|.|:
  Fly   128 ----DKFSRTKVDNLHLWNRMQSQLQCCGVDGPLDYR-RLSLPWSCCSRPEHAYESAC--DTHYK 185

  Fly   175 RGCKVTFVEFWDRNSDIIKYAGLVIAAI 202
            ||| :..|....||..:|...|..|.||
  Fly   186 RGC-LAVVSEQIRNRLLITAFGAAIIAI 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 49/220 (22%)
tetraspanin_LEL 104..188 CDD:239401 22/88 (25%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 49/221 (22%)
uroplakin_I_like_LEL 111..197 CDD:239409 22/94 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.