DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tsp42Eq

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster


Alignment Length:237 Identity:64/237 - (27%)
Similarity:106/237 - (44%) Gaps:30/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIV---FGALLFSKVRNMDDFAEALRTQQVP-VTMIILGT 61
            ||||...:|...|:.:.||.:...|.|.   :..:.||       .:.|:|   || :..|:||.
  Fly     1 MSCGTKALKVSSFVLDFLCCVLAALTIAACSYALIAFS-------HSVAIR---VPSILGIVLGG 55

  Fly    62 IILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWNHRT 126
            ::...:.|||..|:|||..|:..|:.:|..|:..|:.:::   .|...|..:..:.:..||..:.
  Fly    56 LLFFSTIFGCIAALRESIRMTWIYAAILLALVFSQITVIL---AQPINYELLANETIYDAWQGQL 117

  Fly   127 SRSDYMDAIQISMKCCGRSGYTDYAYQGKFPPSCCSDTNNCRWET-VYRRGCK----VTFVE--F 184
            ..||.|...:|...|||::|..:|...|...|..|....|....| :|..||.    ..||:  .
  Fly   118 YHSDRMSYFEIKYHCCGQTGPANYPDSGLVIPQSCYFNQNATVTTDLYTVGCNHQLAAAFVKGTR 182

  Fly   185 WDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIRNYRRRAEY 226
            |::.:|      ..:..:|.:..:.|..||.:::|..||..|
  Fly   183 WEKITD------WSVVGVEILTVIIAGLLAITLQNAERRRLY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 56/219 (26%)
tetraspanin_LEL 104..188 CDD:239401 24/90 (27%)
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 56/219 (26%)
tetraspanin_LEL 95..173 CDD:239401 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.