DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tsp42Ep

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001260759.1 Gene:Tsp42Ep / 35626 FlyBaseID:FBgn0033137 Length:250 Species:Drosophila melanogaster


Alignment Length:233 Identity:55/233 - (23%)
Similarity:95/233 - (40%) Gaps:41/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVP-VTMIILGTIILLISWFGC 71
            :||...:.|||..:.|| .::.||.|..::      ||....:... |..::||..|.:|..|||
  Fly     8 IKYTGLLSNLLYMLLGI-GVMSGAGLGLQM------AEPNTPEHTYFVKSLVLGGSICMIVMFGC 65

  Fly    72 CGAIRESYCMSMTYSILLFVLMIGQ-LALVIY----------MWVQKDKYLEIMGDVVEKAWNHR 125
            .|.:....|:::.:::.:.:.:..: |.|..|          .|.|           :|.||:..
  Fly    66 YGMVANLLCVNLIFTMFILIALAAEYLQLHHYHSPSLRSPGGAWQQ-----------LELAWHGL 119

  Fly   126 TSRSDYMDAIQISMKCCGRSGYTDY-AYQGKFPPSCCSDTNNCRWETVYRRGCKVTFVEFWDRNS 189
            ....:.|...:.|..|||.:|..|| ......|.||.....|...:.:|..||    :|..:|:.
  Fly   120 DRDPELMHQYEASQHCCGYNGADDYKRLHLLVPASCYQAAVNDTAQQIYPSGC----LETLNRSQ 180

  Fly   190 DIIKYAGLV----IAAIEFVGFVFACCLANSIRNYRRR 223
            ..|::...:    |..:|.  |:....:|.|:..:|.|
  Fly   181 RYIQHRDKLYMWAIVGLEI--FILLQTVALSVLLFRLR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 52/225 (23%)
tetraspanin_LEL 104..188 CDD:239401 21/84 (25%)
Tsp42EpNP_001260759.1 Tetraspannin <51..213 CDD:278750 40/178 (22%)
tetraspanin_LEL 91..183 CDD:239401 25/106 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467739
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.