DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and lbm

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster


Alignment Length:230 Identity:63/230 - (27%)
Similarity:107/230 - (46%) Gaps:26/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCGISMVKYILFIFNLLCSICGILLI-VFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIIL 64
            |.|..:.||....:.|   ::.|.|.. ..|.:.:    |.|     ..|::..:...|..::||
  Fly     1 MGCATTSVKIASIVLN---AVLGFLAAGAIGWIAY----NAD-----TETEEFVIAAYIACSLIL 53

  Fly    65 LISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWNHRTSRS 129
            :.:..|...|||||..::.|.::.|.:|.|.|:........:.|  ::...|:||.||     ::
  Fly    54 VFALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCLFLHEFD--VKSGRDMVEVAW-----QA 111

  Fly   130 DYMDAIQISMKCCGRSGYTDYAYQG-KFPPSCCSDTNNCRWETVYRRGCKVTFVEFWDRNSDIIK 193
            :.||::|...:|||:|...||.:.. ..||||.:|..... :.:|..||......|::  ||.::
  Fly   112 NNMDSLQQKHECCGQSSAQDYIHLSLLIPPSCYADLQQTP-DHLYLDGCIEKVQSFYE--SDKLR 173

  Fly   194 Y--AGLVIAAIEFVGFVFACCLANSIRNYRRRAEY 226
            :  ...|:.|.|.:.|..|..||.|.:|.:||.|:
  Fly   174 FIIVSWVLVAFELICFALAVFLAISFKNKQRRMEF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 56/212 (26%)
tetraspanin_LEL 104..188 CDD:239401 24/84 (29%)
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 56/211 (27%)
tetraspanin_LEL <109..169 CDD:239401 19/67 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467728
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.