DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:167 Identity:52/167 - (31%)
Similarity:72/167 - (43%) Gaps:23/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMII----LGT 61
            |.|....||..|...|.|.::.|:.||....|..||               .|:..|:    ||.
  Fly     1 MGCTSGCVKCFLNTLNTLNALSGLSLIAIATLALSK---------------APIAYILFLYGLGG 50

  Fly    62 IILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLE-IMGDVVEKAWNHR 125
            ||.:.:..||||...|:.||:.||..||...:|..| |.|:.:...::|:| ...:.|:..|:..
  Fly    51 IIFVSAVLGCCGICMENVCMTATYGFLLLAQLIISL-LGIFRFKFTEEYIEKFAAEEVQMKWDEE 114

  Fly   126 TSRSDYMDAIQISMKCCGRSGYTDYAYQGK--FPPSC 160
            ......||..|...:||||....||...|:  .||||
  Fly   115 LVEPGAMDIYQTVYECCGRDSPDDYVAIGRQTLPPSC 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 50/160 (31%)
tetraspanin_LEL 104..188 CDD:239401 18/60 (30%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 50/161 (31%)
tetraspanin_LEL 94..174 CDD:239401 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.