DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tsp42Ei

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001260756.1 Gene:Tsp42Ei / 35618 FlyBaseID:FBgn0033130 Length:229 Species:Drosophila melanogaster


Alignment Length:233 Identity:66/233 - (28%)
Similarity:114/233 - (48%) Gaps:20/233 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIVFGA-LLFSKVRNMDDFAEALRTQQVPVTMIILGTIIL 64
            |..|.:.||::|.:.|.:.|:.|:.||.||. .|.|...|    |.::........:|.||.:||
  Fly     1 MGLGATTVKHVLLLLNFVFSVLGLALIAFGIFFLISAAEN----AVSIGKNVAGGLIIALGVVIL 61

  Fly    65 LISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQ----KDKYLEIMGDVVEKAWNHR 125
            :|:.|||..||.|:....:.|...:.:|::.||   |::.:.    ||.....:.:..::.|...
  Fly    62 IIAIFGCLAAIHEAPVRLLIYVGAVVLLILAQL---IFLGMSSHGTKDGISGSINEGFDRLWESE 123

  Fly   126 TSRSDYMDAIQISMKCCGRSGYTDY--AYQGKFPPSCCSDTNNCRWET---VYRRGCKVTFVEFW 185
            .:::..:...:..::|||.:...||  .:.| .|.|||.: :.| .:|   |::.|||..||::.
  Fly   124 RNQTGALSYYESWLQCCGVNSSEDYWIIHHG-IPSSCCPE-SKC-MDTPSRVFKTGCKAAFVKYL 185

  Fly   186 DRNSDIIKYAGLVIAAIEFVGFVFACCLANSIRNYRRR 223
            |....:.|....::...|.||.||...|.:|::|..||
  Fly   186 DDKLLVFKIVCWLLVIGEAVGAVFGWLLYSSVKNQSRR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 60/218 (28%)
tetraspanin_LEL 104..188 CDD:239401 22/92 (24%)
Tsp42EiNP_001260756.1 Tetraspannin 7..217 CDD:278750 60/219 (27%)
DUF373 <17..>101 CDD:299895 27/90 (30%)
tetraspanin_LEL 104..189 CDD:239401 22/87 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467691
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.