DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tsp42Ef

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster


Alignment Length:222 Identity:62/222 - (27%)
Similarity:107/222 - (48%) Gaps:7/222 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILLISWFG 70
            |.||.|::..::||::..::||.|| :..:...|:::..     |......:.||...||:..:|
  Fly     5 SSVKLIVYALDVLCTLLALVLISFG-IYVAVSYNLNEIG-----QLTAYGYVGLGAAALLVVLWG 63

  Fly    71 CCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWNHRTSRSDYMDAI 135
            ...|.||:.|.::|:.|.|.:::|.|.|:|..:..|:......:.:.:|..|....:....|...
  Fly    64 YLSAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEELNSPGAMSLY 128

  Fly   136 QISMKCCGRSGYTDYAYQGKFPP-SCCSDTNNCRWETVYRRGCKVTFVEFWDRNSDIIKYAGLVI 199
            |...:||||....||....:.|| :|..:.:..:.|.:...||:|.|..:|...:.|.....||:
  Fly   129 QNWFQCCGRGSPQDYIVNERLPPETCFRNHDKSKPENLIHTGCRVEFENYWQHLTKIFNILALVL 193

  Fly   200 AAIEFVGFVFACCLANSIRNYRRRAEY 226
            ...|.:..|.:|.|.|||||..||:.:
  Fly   194 IGFELLLSVISCRLCNSIRNDARRSYF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 55/209 (26%)
tetraspanin_LEL 104..188 CDD:239401 20/84 (24%)
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 55/209 (26%)
tetraspanin_LEL 103..181 CDD:239401 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443015
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.