DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tsp33B

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster


Alignment Length:251 Identity:46/251 - (18%)
Similarity:80/251 - (31%) Gaps:93/251 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VTMIILGTIILLISWF---GCCGAIRESYCMSMTYSILLFVLMIG-------------------- 95
            :|..::|.:||:::.:   ...|.:.:..| .:.|..|..:.:.|                    
  Fly    17 ITEAVIGLLILVVTAYYHTVLTGYLSDIEC-RLVYGYLFGIYVFGAQVVVTFLCSIAMWRRIWRR 80

  Fly    96 ----QLALVIYMWVQKDKYLEIMG-----------DVVEKAWNHRTSRSDYM-----------DA 134
                .:.|::.:|......:...|           ||:|.|.:...:|...|           |.
  Fly    81 RCTPNIRLLLSVWAFYSCVIIASGFGCVWNLYRGVDVLENAADTSLTRGIDMYYSCPEWKLLWDG 145

  Fly   135 IQISMKCCGRSGYTDYAYQGKFPP-------------SCC-----------------SDTNNCRW 169
            :|...:|||..||.|:......|.             :||                 |...|.|.
  Fly   146 LQWHKECCGVHGYKDWMNAEWMPRRENNCTSMVLAPFACCKRSCDSCFNNFLPSEGQSIGGNSRQ 210

  Fly   170 -------ETVYRRGCKVTFVE-FWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSI 217
                   :::...||...||. .|  |...|..| |.:.|::|:  :..||:...|
  Fly   211 PFPALTVDSINANGCLPAFVSAVW--NCFYILMA-LWVLALKFL--IVLCCMTKFI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 45/249 (18%)
tetraspanin_LEL 104..188 CDD:239401 27/143 (19%)
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 42/241 (17%)
CD151_like_LEL 112..237 CDD:239408 26/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443016
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.