DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:253 Identity:56/253 - (22%)
Similarity:110/253 - (43%) Gaps:34/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILL 65
            ::.|:...||:|.|.:.:.::..||||:.|..:.:...:...|.:. .....|..:|.:|.|::.
  Fly     8 LNSGMKCAKYMLIIVSFMFALTAILLIMVGTTIQTIFGDFSLFIDG-HFSSPPALLIAIGFILIA 71

  Fly    66 ISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKA---WNHRTS 127
            ::..|..||::||..:...|.:.||::.|.:::..|..:|.:.:...::...:.:|   :.|...
  Fly    72 VAALGAYGAVKESVMVINLYGVCLFLVFILEVSAAIAAFVMQSQVRGMLIRTMNQALAEYEHDPY 136

  Fly   128 RSDYMDAIQISMKCCG---RSGYTDYAYQG----------KFPPSCC-------SDTNNCRWETV 172
            ....:|.:|..::|||   ...:.||....          ..|.|||       :|:........
  Fly   137 VESGVDFMQSMLECCGVNEPEDWKDYLSANVNFTLGVDDVVVPNSCCGNQPTSLNDSTQMTCMET 201

  Fly   173 YRRGC--KVTFVEFWDRNSDIIKYAGLVIAAIEFVGFVFACCLA------NSIRNYRR 222
            |..||  |:.|:.  .:::.:|......:|.::.:|.:.|..||      .|||..||
  Fly   202 YDYGCFRKMNFIV--SQSAMLIATGATTVAFVQLLGVLCAFMLAKTLRRNKSIREARR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 50/239 (21%)
tetraspanin_LEL 104..188 CDD:239401 20/108 (19%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 50/234 (21%)
tetraspanin_LEL 110..218 CDD:239401 20/109 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.