DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tsp26A

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster


Alignment Length:312 Identity:67/312 - (21%)
Similarity:117/312 - (37%) Gaps:99/312 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPV----TMIILGT 61
            :||   .:||:||..|::..:..:|::..|...:|: :.|  |....|...:.:    .:||||.
  Fly    15 ISC---CLKYLLFASNVILWLSALLVLSVGIWAWSE-KGM--FRNIARLHFIALDPAFVLIILGG 73

  Fly    62 IILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKA----- 121
            :..|:.:.|..||:||:.|:...|:|.|.||:|.::......:|.|||     |.:.::|     
  Fly    74 VTFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDK-----GWIKDQATEGLK 133

  Fly   122 -----WNHRTSRSDYMDAIQIS-MKCCGRSGYTDYAYQGKF---------------PPSCCS--- 162
                 :.....:.:.:|.||.. ::|||..|..|:.....|               |.|||.   
  Fly   134 AFIRHYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRP 198

  Fly   163 --------------------DTN----NC-----RW------------------------ETVYR 174
                                |.|    .|     .|                        :.:|.
  Fly   199 QEVIKNKQCGYDVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGMELSKIIYE 263

  Fly   175 RGCKVTFVEFWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIRNYRRRAEY 226
            :||.....|:.:.|..||....:|:...:.:|..||..|...|  |.:::::
  Fly   264 KGCVQAGEEWMEHNLIIISATVIVVMFFQILGICFAQNLRADI--YTQKSKW 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 63/294 (21%)
tetraspanin_LEL 104..188 CDD:239401 27/165 (16%)
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 51/242 (21%)
DUF2207 <65..157 CDD:303056 26/96 (27%)
TM4SF9_like_LEL 118..239 CDD:239412 22/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.