DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tsp2A

DIOPT Version :10

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_525037.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster


Alignment Length:174 Identity:34/174 - (19%)
Similarity:67/174 - (38%) Gaps:67/174 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 PAKSAPTSAASFLVDDVQDSSLRQFCLG--SFLESSRVLPH--HDVVNVLDCVYSATDNKENILE 662
            |.|:...|:|   ||.:...|:|:| :|  :.:.::..|.|  |:         |.||..:.:.:
  Fly   336 PPKTIFNSSA---VDIIVTHSIRRF-IGNETTIRANGSLLHYRHN---------SYTDPAKEVQK 387

  Fly   663 QFQTFLEEALTAELNAPNPTNPNVRKLREKLSQAQEAADGDSQLENESIKLAGSSRTSCSSS--- 724
            .:..|           .:..|.:::::::.|.                 |:.|||....:|:   
  Fly   388 PYSLF-----------TSYPNLHIKRIQKTLR-----------------KVFGSSIPPYNSTYLH 424

  Fly   725 EMDDCFDPEFEKIEKSEVVGELPKIEHGTRHGKRRDSIEYMSDW 768
            .::.|.         :::|||          ||.|.::||...|
  Fly   425 VLNQCI---------TKIVGE----------GKCRSTVEYCKQW 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspanin 8..215 CDD:459767
Tsp2ANP_525037.1 Tetraspanin 19..230 CDD:459767
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.