DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tspan3

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001005547.1 Gene:Tspan3 / 300733 RGDID:1359444 Length:253 Species:Rattus norvegicus


Alignment Length:229 Identity:63/229 - (27%)
Similarity:107/229 - (46%) Gaps:21/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CGISMVKYILFIFNLL-CSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILLI 66
            |||:..|.:|...||: ....|||..| ||.:|....:.|.|.|.:.|....|.::.:|.::.:|
  Rat     4 CGITSSKTVLVFLNLIFWGAAGILCYV-GAYVFITYDDYDHFFEDVYTLFPAVVIMAVGALLFII 67

  Fly    67 SWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAW-NHRTSRSD 130
            ...|||..||||.|...|:..:|.::.:.::.:|:..:|.:.|....:...::|.: .:..:.||
  Rat    68 GLIGCCATIRESRCGLATFVFILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKTYNGTNSD 132

  Fly   131 ----YMDAIQISMKCCGRSGYTDYAYQGKF--------PPSCCSDT-NNCRW-----ETVYRRGC 177
                .:|.:|..:.|||...|:|:.....|        |.|||.:| .:|..     ..:|..||
  Rat   133 AASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETARSCNGSLANPSDLYAEGC 197

  Fly   178 KVTFVEFWDRNSDIIKYAGLVIAAIEFVGFVFAC 211
            :...|:........:.:|.|..|||:.:|.:.||
  Rat   198 EALVVKKLQEILMHVIWAALAFAAIQLLGMLCAC 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 60/224 (27%)
tetraspanin_LEL 104..188 CDD:239401 23/102 (23%)
Tspan3NP_001005547.1 Tetraspannin 10..237 CDD:278750 60/223 (27%)
TM4SF8_like_LEL 104..210 CDD:239416 23/105 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.