DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and TSPAN16

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_036598.1 Gene:TSPAN16 / 26526 HGNCID:30725 Length:245 Species:Homo sapiens


Alignment Length:249 Identity:52/249 - (20%)
Similarity:100/249 - (40%) Gaps:65/249 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SMVKYILFIFNLLCSICGILLI---VFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILLIS 67
            |.:|.:|.:.|...::.||:|:   :.|....:.:.|:...:.|. ...|....:::|.|.:|:.
Human     9 SSLKKLLSLLNGFVAVSGIILVGLGIGGKCGGASLTNVLGLSSAY-LLHVGNLCLVMGCITVLLG 72

  Fly    68 WFGCCGAIRES-----YCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVV--------- 118
            ..|..||.:||     :|:   .|:::.::|....|.|:.:      :..|:|||.         
Human    73 CAGWYGATKESRGTLLFCI---LSMVIVLIMEVTAATVVLL------FFPIVGDVALEHTFVTLR 128

  Fly   119 --EKAWNHRTSRSDYMDAIQISMKCCGRSGYTDYAYQG-------KFPPSCCS-------DTNNC 167
              .:.:|.....|...:.:...:||||.:.|||::...       .:|.|||.       |..:.
Human   129 KNYRGYNEPDDYSTQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGHTYPRSCCKSIGSVSCDGRDV 193

  Fly   168 RWETVYRRGC-----KVT---------------FVEFWDRNSDIIKYAGLVIAA 201
            ....::::||     |:|               .::.|  .|..:..|||.:.|
Human   194 SPNVIHQKGCFHKLLKITKTQSFTLSGSSLGAAVIQRW--GSRYVAQAGLELLA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 51/247 (21%)
tetraspanin_LEL 104..188 CDD:239401 23/128 (18%)
TSPAN16NP_036598.1 Tetraspannin 19..232 CDD:278750 44/224 (20%)
uroplakin_I_like_LEL 120..215 CDD:239409 18/94 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.