DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Cd81

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_037219.2 Gene:Cd81 / 25621 RGDID:2315 Length:236 Species:Rattus norvegicus


Alignment Length:225 Identity:50/225 - (22%)
Similarity:96/225 - (42%) Gaps:15/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVT-------MIILGTIILL 65
            :||:||:||.:..:.|.:::.....|....:........|..:..|.|       :|.:|.:::.
  Rat    10 IKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTSLLYLELGDKPAPSTFYVGIYILIAVGAVMMF 74

  Fly    66 ISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWNHRTSRSD 130
            :.:.||.|||:||.|:..|:...|.:|...::|..|:.:|.||:..:.:....::|........|
  Rat    75 VGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDD 139

  Fly   131 YMDAIQI------SMKCCGRSGYTDYAYQGKFPPSCCSDTNNCRWETVYRRGCKVTFVEFWDRNS 189
            ..:|..:      ::.|||.:..|...........|.|.:|:  :..:.:..|.....|.:....
  Rat   140 ANNAKAVVKTFHETLNCCGSNTLTTLTTTVLRNSLCPSSSNS--FTQLLKEDCHQKIDELFSGKL 202

  Fly   190 DIIKYAGLVIAAIEFVGFVFACCLANSIRN 219
            .:|..|.:|:|.|.....:.:..|...|||
  Rat   203 YLIGIAAIVVAVIMIFEMILSMVLCCGIRN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 47/221 (21%)
tetraspanin_LEL 104..188 CDD:239401 15/89 (17%)
Cd81NP_037219.2 Tetraspannin 10..226 CDD:395265 46/217 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.