DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tspan8

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001162150.1 Gene:Tspan8 / 216350 MGIID:2384918 Length:235 Species:Mus musculus


Alignment Length:229 Identity:66/229 - (28%)
Similarity:117/229 - (51%) Gaps:27/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQ------VPVTMII-LGTII 63
            |.:||.:|.||.|..:||.|::  |..::  ||...|..|.:.:..      :.|.::| :|:||
Mouse     6 SCLKYSMFFFNFLFWVCGTLIL--GLAIW--VRVSKDGKEIITSGDSSTNPFIAVNILIAVGSII 66

  Fly    64 LLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVV---EKAWNHR 125
            :::.:.|||||::||.||.:.:.|.|.:::|.|:|..|.....|.:|..|:.:.:   .|..:..
Mouse    67 MVLGFLGCCGAVKESRCMLLLFFIGLLLILILQVAAGILGAAFKPEYNRILNETLYENAKLLSDN 131

  Fly   126 TSRS-DYMDAI---QISMKCCG-RSGYTDYA---YQGKFPPSC-CSDTNNCRWE--TVYRRGCKV 179
            |..: |:..|:   |...|||| .:|..|:.   .:.|  .|| |:.|:...::  :||.:.|..
Mouse   132 TDEAKDFQKAMIVFQSEFKCCGLENGAADWGNNFVEAK--ESCQCTGTDCATYQGSSVYPKTCLS 194

  Fly   180 TFVEFWDRNSDIIKYAGLVIAAIEFVGFVFACCL 213
            ...:.:::|..|:......:|.||.:|.||:..|
Mouse   195 LIKDLFEKNIIIVIGIAFGLAVIEILGLVFSMVL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 65/227 (29%)
tetraspanin_LEL 104..188 CDD:239401 22/97 (23%)
Tspan8NP_001162150.1 Tetraspannin 8..228 CDD:366035 64/225 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.